SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000002848 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000002848
Domain Number 1 Region: 418-446,480-584,706-821
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.53e-54
Family Phosphate binding protein-like 0.0000000965
Further Details:      
 
Domain Number 2 Region: 51-411
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.32e-25
Family L-arabinose binding protein-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000002848   Gene: ENSMUSG00000002771   Transcript: ENSMUST00000002848
Sequence length 1323
Comment pep:known chromosome:GRCm38:7:45831883:45867129:-1 gene:ENSMUSG00000002771 transcript:ENSMUST00000002848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGGPRGPRGPAKMLLLLALACASPFPEEVPGPGAAGGGTGGARPLNVALVFSGPAYA
AEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDDSRA
PAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLEEYD
WTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLGAQLRSVSAQI
RLLFCAREEAEPVFRAAEEAGLTGPGYVWFMVGPQLAGGGGSGVPGEPLLLPGGAPLPAG
LFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESLHRY
FMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRFL
QPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKRC
CKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTIN
EERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFI
FEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVLVWA
FFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEKNIR
SNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGSGKV
FATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKLDID
NMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAEAAP
PPAKPPPPPQPLPSPAYPAARPPPGPAPFVPRERAAADRWRRAKGTGPPGGAALADGFHR
YYGPIEPQGLGLGEARAAPRGAAGRPLSPPTTQPPQKPPPSYFAIVREQEPAEPPAGAFP
GFPSPPAPPAAAAAAVGPPLCRLAFEDESPPAPSRWPRSDPESQPLLGGGAGGPSAGAPT
APPPRRAAPPPCAYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYPYAERLGPPPGR
YWSVDKLGGWRAGSWDYLPPRGGPAWHCRHCASLELLPPPRHLSCSHDGLDGGWWAPPPP
PWAAGPPPRRRARCGCPRPHPHRPRASHRAPAAAPHHHRHRRAAGGWDLPPPAPTSRSLE
DLSSCPRAAPTRRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDLGTRRGSAHFSSLE
SEV
Download sequence
Identical sequences Q03391
NP_032198.2.92730 XP_011249107.1.92730 ENSMUSP00000002848 ENSMUSP00000002848 ENSMUSP00000002848 10090.ENSMUSP00000002848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]