SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000002923 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000002923
Domain Number 1 Region: 5-352
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 5.1e-71
Family ADP-ribosylglycohydrolase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000002923   Gene: ENSMUSG00000002844   Transcript: ENSMUST00000002923
Sequence length 362
Comment pep:known chromosome:GRCm38:16:38445399:38452689:-1 gene:ENSMUSG00000002844 transcript:ENSMUST00000002923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGGLIERYVAAMVLSAAGDTLGYFNGKWEFIRDGETIHQQLAQMGDLEAIDVARWRVSD
DTVMHLATAEALMEAGQSPDLPRLYSLLAKHYRDCMGDMDGRAPGGACMQNAMLLQPNRA
DGYRIPFNSHEGGCGAAMRAMCIGLRFPHPSQLDLLIQVSIESGRMTHHHPTGYLGSLAS
ALFTAYAVNGKSPWQWGKGLMEVLPEAKKYITQSGYFVKENLQHWSYFEKEWEKYLELRG
ILDGNSAPVFPQPFGVKERDQFYIDVSYSGWGGSSGHDAPMIAYDALLAAGDSWKELAHR
AFFHGGDSDSTAAIAGCWWGVMYGFKGVNPANYEKLEYRQRLEEAGRALYSLGSKEDPVL
DP
Download sequence
Identical sequences P54923 Q3U5N4
354814 10090.ENSMUSP00000002923 NP_031440.1.92730 ENSMUSP00000002923 ENSMUSP00000002923 ENSMUSP00000002923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]