SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000004786 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000004786
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 8.76e-46
Family Eukaryotic RPB5 N-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 135-209
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 3.4e-30
Family RPB5 0.0000834
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000004786   Gene: ENSMUSG00000004667   Transcript: ENSMUST00000004786
Sequence length 210
Comment pep:known chromosome:GRCm38:10:80035949:80039795:-1 gene:ENSMUSG00000004667 transcript:ENSMUST00000004786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Download sequence
Identical sequences B0BNE2 Q3V214 Q80UW8
NP_001103084.1.100692 NP_001103084.1.4139 NP_079830.2.92730 XP_004654929.1.11716 XP_005359142.1.66349 XP_006978272.1.50099 XP_007614962.1.28591 XP_007641373.1.69978 XP_008835404.1.79516 XP_008835405.1.79516 XP_021060980.1.100879 ENSRNOP00000018169 ENSMUSP00000004786 ENSMUSP00000004786 ENSMUSP00000004786 ENSRNOP00000018169 10090.ENSMUSP00000004786 10116.ENSRNOP00000018169 GO.52388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]