SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000007977 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000007977
Domain Number 1 Region: 29-486
Classification Level Classification E-value
Superfamily ALDH-like 7.98e-91
Family ALDH-like 0.00000296
Further Details:      
 
Domain Number 2 Region: 506-768
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-41
Family ALDH-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000007977   Gene: ENSMUSG00000007833   Transcript: ENSMUST00000007977
Sequence length 802
Comment pep:known chromosome:GRCm38:7:45140905:45154573:-1 gene:ENSMUSG00000007833 transcript:ENSMUST00000007977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATRVQPSTREIFTTLEYGPVPESHACALAWLDTHNRLLGHHVNGMWLKPEHRNPAPCQ
DPITGENLASCLQAEAEDIAAAVEAAKIAFKAWSQLPGAARGQHLTRLAKVVQKHQRLLW
TLESLVTGRAVREVRDGDVPLAQQLLQYHAVQAHAQGDALADWQPVGVIGLILPTPFSFL
DMMWRVCPALAMGCTVVALVPPAFPTPLLLAQLAGELGSFPGILNVVCGPASLGPVLASQ
PGVQKVAFCGAVEEGRVLRRTLAGRGAELGLALGTESLLLLMDSADVDSAVEGVVDAVWS
DRSLGGLRLLIQESVWDEAMRRLQARMAQIRSGRGLDGAVDMGARGAAARDLAQSFVDEA
QSQGGQVFQAGDVPSSSPFFSPALVSGLPPAAPCAQAEVPWPVVMASPFRTVKEALALAN
GTPRGGSASVWSERLGQALELGYGLQVGTVWINAHGLRDPAVPTGGCKESGSSWHGGPDG
LYEYLQPLGTPSQESFLCENINYDTFGLAASSILPSGPETGPSPAPPYGLFVGGRFQSPG
TQSSRPIQDSSGKVSSYVAEGGAKDIRGAVEAAHQAAPGWGAQSPRARAGLLWALAAALE
RRKPVLTSQLERHGAAPTVAKIEVELSVRRLQTWGTRVQDQGQTLQVTGLRGPVLRLREP
LGVLAVVCPDEWPLLAFVSLLAPALAHGNAVVLVPSGACPLLALEVCQDIAPLFPAGLVS
VVTGDRDHLTRCLALHQDVQALWYFGSAQGSQFVEWASAGNLKSVWVNRGFPRAWDVEVQ
GAGQELSLHAARTKALWLPMGD
Download sequence
Identical sequences A0A1B0GSU0
NP_666066.1.92730 ENSMUSP00000007977 10090.ENSMUSP00000007977 ENSMUSP00000007977 ENSMUSP00000007977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]