SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000014578 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000014578
Domain Number 1 Region: 560-811
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.37e-83
Family Eukaryotic proteases 0.0000000541
Further Details:      
 
Domain Number 2 Region: 364-465
Classification Level Classification E-value
Superfamily Kringle-like 1.19e-39
Family Kringle modules 0.0000164
Further Details:      
 
Domain Number 3 Region: 272-358
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-37
Family Kringle modules 0.0000182
Further Details:      
 
Domain Number 4 Region: 90-185
Classification Level Classification E-value
Superfamily Kringle-like 1.76e-34
Family Kringle modules 0.0000265
Further Details:      
 
Domain Number 5 Region: 464-569
Classification Level Classification E-value
Superfamily Kringle-like 4.61e-34
Family Kringle modules 0.0000106
Further Details:      
 
Domain Number 6 Region: 183-269
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-34
Family Kringle modules 0.0000115
Further Details:      
 
Domain Number 7 Region: 19-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 8.24e-20
Family Hairpin loop containing domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000014578   Gene: ENSMUSG00000059481   Transcript: ENSMUST00000014578
Sequence length 812
Comment pep:known chromosome:GRCm38:17:12378609:12419384:1 gene:ENSMUSG00000059481 transcript:ENSMUST00000014578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGGVSDCLAKCEGETDFV
CRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECKTGIGNGYRGTMSRTKS
GVACQKWGATFPHVPNYSPSTHPNEGLEENYCRNPDNDEQGPWCYTTDPDKRYDYCNIPE
CEEECMYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPAKFPSKNLKMNYCRNPDGE
PRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRGENYRGTVSVTVSGKTCQRWS
EQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDSQLRWEYCEIPSCESSASPDQ
SDSSVPPEEQTPVVQECYQSDGQSYRGTSSTTITGKKCQSWAAMFPHRHSKTPENFPDAG
LEMNYCRNPDGDKGPWCYTTDPSVRWEYCNLKRCSETGGSVVELPTVSQEPSGPSDSETD
CMYGNGKDYRGKTAVTAAGTPCQGWAAQEPHRHSIFTPQTNPRAGLEKNYCRNPDGDVNG
PWCYTTNPRKLYDYCDIPLCASASSFECGKPQVEPKKCPGRVVGGCVANPHSWPWQISLR
TRFTGQHFCGGTLIAPEWVLTAAHCLEKSSRPEFYKVILGAHEEYIRGLDVQEISVAKLI
LEPNNRDIALLKLSRPATITDKVIPACLPSPNYMVADRTICYITGWGETQGTFGAGRLKE
AQLPVIENKVCNRVEYLNNRVKSTELCAGQLAGGVDSCQGDSGGPLVCFEKDKYILQGVT
SWGLGCARPNKPGVYVRVSRFVDWIEREMRNN
Download sequence
Identical sequences P20918
ENSMUSP00000014578 NP_032903.3.92730 ENSMUSP00000014578 10090.ENSMUSP00000014578 ENSMUSP00000014578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]