SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000015666 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000015666
Domain Number 1 Region: 342-444
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.01e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 153-207,234-249,277-295
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000154
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 80-154
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000115
Family HLH, helix-loop-helix DNA-binding domain 0.0062
Further Details:      
 
Domain Number 4 Region: 555-716
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0000033
Family Tetraviridae-like VP 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000015666   Gene: ENSMUSG00000015522   Transcript: ENSMUST00000015666
Sequence length 771
Comment pep:known chromosome:GRCm38:3:95434428:95495571:1 gene:ENSMUSG00000015522 transcript:ENSMUST00000015666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATTANPEMTSDVPSLGPTIASGNPGPGIQGGGAVVQRAIKRRSGLDFDDEVEVNTKFL
RCDDDQMCNDKERFASTLFWRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMK
SLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQP
QSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRVLDLKTGTVKKEGQQSSMRMCMGSR
RSFICRMRCGTSSVDPVSMNRLSFLRNRCRNGLGSVKEGEPHFVVVHCTGYIKAWPPAGV
SLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNICQPTEFISRHNIEGIFTFVDHRC
VATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKTREWLWMR
TSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIPRSQLGPTANLSLEMGTGQLP
SRQQQQQHTELDMVPGRDGLASYNHSQVSVQPVASAGSEHSKPLEKSEGLFAQDRDPRFP
EIYPSITADQSKGISSSTVPATQQLFSQGSSFPPNPRPAENFRNSGLTPPVTIVQPSSSA
GQILAQISRHSNPAQGSAPTWTSSSRPGFAAQQVPTQATAKTRSSQFGVNNFQTSSSFSA
MSLPGAPTASSGTAAYPALPNRGSNFPPETGQTTGQFQARTAEGVGVWPQWQGQQPHHRS
SSSEQHVQQTQAQAPSQPEVFQEMLSMLGDQSNTYNNEEFPDLTMFPPFSE
Download sequence
Identical sequences E9QLT6
ENSMUSP00000015666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]