SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000015680 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000015680
Domain Number 1 Region: 46-186
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 9.02e-46
Family Molybdopterin synthase subunit MoaE 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000015680   Gene: ENSMUSG00000015536   Transcript: ENSMUST00000015680
Sequence length 189
Comment pep:known chromosome:GRCm38:13:114818277:114828723:1 gene:ENSMUSG00000015536 transcript:ENSMUST00000015680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISNSCFSPEMRLPSSRQSVEDNASEPSGKDVDDVQEKPKDIIQFTAEKLSVGEVS
QLVVSPLCGAVSLFVGTTRNNFEGKKVISLEYEAYVPMAENEIRKICNDIRQKWPVRHIA
VFHRLGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAKVPIWKKEIYEESTSSWKRN
KECFWAAGD
Download sequence
Identical sequences A0A0R4J206
ENSMUSP00000015680 ENSMUSP00000125797 ENSMUSP00000139298 ENSMUSP00000015680 NP_001106845.1.92730 10090.ENSMUSP00000015680 ENSMUSP00000015680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]