SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000016144 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000016144
Domain Number 1 Region: 10-248
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 5.63e-27
Family Type 2 phosphatidic acid phosphatase, PAP2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000016144   Gene: ENSMUSG00000021759   Transcript: ENSMUST00000016144
Sequence length 284
Comment pep:known chromosome:GRCm38:13:112800894:112867881:1 gene:ENSMUSG00000021759 transcript:ENSMUST00000016144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDKTRLPYVALDVICVLLAAMPMTILKLGKVYPFQRGFFCTDNSVKYPYHDSTIPSRIL
AILGLGLPIFSMSIGESLSVYFNVLHSNSFVGNPYIATIYKAVGAFLFGVSASQSLTDIA
KYTIGSLRPHFLAICNPDWSKINCSDGYIEDYICQGNEEKVKEGRLSFYSGHSSFSMYCM
LFVALYLQARMKGDWARLLRPMLQFGLIAFSIYVGLSRVSDYKHHWSDVTVGLIQGAAMA
ILVALYVSDFFKDTHSYKERKEEDPHTTLHETASSRNYSTNHEP
Download sequence
Identical sequences ENSMUSP00000064423 10090.ENSMUSP00000016144 NP_032273.1.92730 ENSMUSP00000016144 ENSMUSP00000016144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]