SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000017451 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000017451
Domain Number 1 Region: 29-135
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.41e-37
Family Acyl-CoA thioesterase 0.00014
Further Details:      
 
Domain Number 2 Region: 139-246
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.64e-17
Family Acyl-CoA thioesterase 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000017451   Gene: ENSMUSG00000017307   Transcript: ENSMUST00000017451
Sequence length 268
Comment pep:putative chromosome:GRCm38:2:164792768:164804882:-1 gene:ENSMUSG00000017307 transcript:ENSMUST00000017451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPEGLGDAHGDADRGDLSGDLRSVLVTSVLNLEPLDEDLYRGRHYWVPTSQRLFGGQI
MGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKVPVLYHVERIRTGASFSVRAVKAVQHGK
AIFICQASFQQMQPSPLQHQFSMPSVPPPEDLLDHEALIDQYLRDPNLHKKYRVGLNRVA
AQEVPIEIKVVNPPTLTQLQALEPKQMFWVRARGYIGEGDIKMHCCVAAYISDYAFLGTA
LLPHQSKYKVALEGWCMGGCGVGMGSLL
Download sequence
Identical sequences Q8BZR4
ENSMUSP00000017451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]