SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020286 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020286
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.28e-108
Family Inorganic pyrophosphatase 0.0000000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020286   Gene: ENSMUSG00000020089   Transcript: ENSMUST00000020286
Sequence length 289
Comment pep:known chromosome:GRCm38:10:61648552:61674168:1 gene:ENSMUSG00000020089 transcript:ENSMUST00000020286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSSEERAAPFTLEYRVFLKNEKGQYISPFHDVPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHSDKHTGCCGDNDPI
DVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINVDDPDAANYKDISDVERLKP
GYLEATVDWFRRYKVPDGKPENEFAFNAEFKNKDFAVDIIKSTHDYWKALVTKKTDGKGI
SCMNTTVSESPFKCDPDAAKAIVDALPPPCESACSLPTDVDKWFHQQKN
Download sequence
Identical sequences Q4FK49 Q9D819
ENSMUSP00000020286 ENSMUSP00000020286 10090.ENSMUSP00000020286 ENSMUSP00000020286 NP_080714.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]