SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020497 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020497
Domain Number 1 Region: 433-922
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-165
Family ALDH-like 0.000000000793
Further Details:      
 
Domain Number 2 Region: 23-223
Classification Level Classification E-value
Superfamily Formyltransferase 1.05e-49
Family Formyltransferase 0.0000000195
Further Details:      
 
Domain Number 3 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.24e-24
Family Post formyltransferase domain 0.0000132
Further Details:      
 
Domain Number 4 Region: 345-432
Classification Level Classification E-value
Superfamily ACP-like 0.00000929
Family Acyl-carrier protein (ACP) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020497   Gene: ENSMUSG00000020256   Transcript: ENSMUST00000020497
Sequence length 923
Comment pep:known chromosome:GRCm38:10:83487450:83534140:-1 gene:ENSMUSG00000020256 transcript:ENSMUST00000020497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWRGSQALRHFSTSRVYFKNKLKLALIGQSLFGQEVYSQLLKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKFPRWRLKGKTIKEVAEAYQSVGAELNVLPFCTQFIPMDVIDSP
KHGSIIYHPSLLPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVKPND
TVDSLYNRFLFPEGIKAMVEAVQLIADGKAPRTPQPEEGATYEGIQKKENAEVSWDQPAE
GLHNWIRGHDKVPGAWAEINGQMVTFYGSSLLTSSVPSGEPLDIRGAKKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGKMIPASQYFSAGETSVVELTAEELKVAETIKVIWARILSNTP
VIEDSTDFFKSGASSMDVVRLVEEIRQSCGGLQLQNEDVYMATKFGDFIQKVVRRLRGED
EEAEMVVDYVSKEVNGMTVKIPYQCFINGQFVDAEDGETYATVNPTDGTTICRVSYASLA
DVDRAVAAAKDAFENGEWGRMNARDRGRLMYRLADLMEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNYNLTFTKKEPLGACAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELTVKAGFPKGVINIIPGSGGVAGQRLSQ
HPDIRKLGFTGSTSVGKQIMKSCAVSNLKKVSLELGGKSPLIIFSDCDLEKAVRMGMGAV
FFNKGENCIAAGRLFVEEAIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHRAHLEKLL
QYCETGVQEGATLVYGGRQVQRPGFFMEPTVFTGVEDHMYLAKEESFGPIMVISKFQNGD
IDGVLQRANNTEYGLASGVFTRDINKAMYVSDKLEAGTVFINTYNKTDVAAPFGGMKQSG
FGKDLGEEALNEYLKIKTVTLEY
Download sequence
Identical sequences Q8K009
ENSMUSP00000020497 ENSMUSP00000020497 NP_705771.2.92730 10090.ENSMUSP00000020497 ENSMUSP00000020497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]