SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020662 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020662
Domain Number 1 Region: 30-126
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-28
Family Kringle modules 0.00078
Further Details:      
 
Domain Number 2 Region: 214-320
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-24
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020662   Gene: ENSMUSG00000020393   Transcript: ENSMUST00000020662
Sequence length 473
Comment pep:known chromosome:GRCm38:11:5191552:5261558:-1 gene:ENSMUSG00000020393 transcript:ENSMUST00000020662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAARLALLSAAALTLAARPAPGPRSGPECFTANGADYRGTQSWTALQGGKPCLFWNE
TFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNL
GCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKHGE
AASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMAAVVYSPDFPDTYATGRVC
YWTIRVPGASRIHFNFTLFDIRDSADMVELLDGYTHRVLVRLSGRSRPPLSFNVSLDFVI
LYFFSDRINQAQGFAVLYQATKEEPPQERPAVNQTLAEVITEQANLSVSAAHSSKVLYVI
TPSPSHPPQTAPGSHSWAPSVGANSHRVEGWTVYGLATLLILTVTAVVAKILLHVTFKSH
RVPASGDLRDCRQPGASGDIWTIFYEPSTTISIFKKKLKGQSQQDDRNPLVSD
Download sequence
Identical sequences Q99N43
ENSMUSP00000020662 NP_115772.2.92730 10090.ENSMUSP00000020662 ENSMUSP00000020662 ENSMUSP00000020662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]