SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020689 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020689
Domain Number 1 Region: 25-63
Classification Level Classification E-value
Superfamily The spindle assembly checkpoint protein mad2 0.000000000942
Family The spindle assembly checkpoint protein mad2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020689   Gene: ENSMUSG00000020419   Transcript: ENSMUST00000020689
Sequence length 65
Comment pep:known chromosome:GRCm38:11:4345814:4441103:-1 gene:ENSMUSG00000020419 transcript:ENSMUST00000020689 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MATAQLSHNTRTLKASKNTIFPSQVTNEHESLVVVKKLFATCISCITYLRGLFPESSYRD
RRLDA
Download sequence
Identical sequences H7BWX7
ENSMUSP00000020689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]