SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020886 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020886
Domain Number 1 Region: 188-424
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.22e-58
Family NadC C-terminal domain-like 0.053
Further Details:      
 
Domain Number 2 Region: 247-485
Classification Level Classification E-value
Superfamily PDB 1.18e-56
Family PDB 0.027
Further Details:      
 
Domain Number 3 Region: 10-223
Classification Level Classification E-value
Superfamily PDB 6.45e-52
Family PDB 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020886   Gene: ENSMUSG00000020572   Transcript: ENSMUST00000020886
Sequence length 491
Comment pep:known chromosome:GRCm38:12:32820335:32853369:1 gene:ENSMUSG00000020572 transcript:ENSMUST00000020886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKVRKVKYEETVFY
GLQYILNKYLKGKVVTKEKIQEAKEVYREHFQDDVFNERGWNYILEKYDGHLPIEVKAVP
EGSVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETS
GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPGY
SVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIV
SRSTEAPLIIRPDSGNPLDTVLKVLDILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINT
LQEIVEGMKQKKWSIENVSFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGVNVFKDPVAD
PNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKNA
QLNIEQDVAPH
Download sequence
Identical sequences Q99KQ4
10090.ENSMUSP00000020886 NP_067499.2.92730 XP_021057391.1.100879 2gvl_A 2gvl_B ENSMUSP00000020886 354492 ENSMUSP00000020886 ENSMUSP00000020886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]