SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021038 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021038
Domain Number 1 Region: 375-506
Classification Level Classification E-value
Superfamily C-type lectin-like 6.53e-42
Family C-type lectin domain 0.0000877
Further Details:      
 
Domain Number 2 Region: 234-367
Classification Level Classification E-value
Superfamily C-type lectin-like 1.51e-37
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 3 Region: 827-952
Classification Level Classification E-value
Superfamily C-type lectin-like 1.06e-34
Family C-type lectin domain 0.00033
Further Details:      
 
Domain Number 4 Region: 517-652
Classification Level Classification E-value
Superfamily C-type lectin-like 3.09e-33
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 662-812
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-29
Family C-type lectin domain 0.00044
Further Details:      
 
Domain Number 6 Region: 40-171
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.23e-23
Family Cysteine rich domain 0.0021
Further Details:      
 
Domain Number 7 Region: 171-229
Classification Level Classification E-value
Superfamily Kringle-like 1.51e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021038   Gene: ENSMUSG00000020695   Transcript: ENSMUST00000021038
Sequence length 1053
Comment pep:novel chromosome:GRCm38:11:105292668:105343871:1 gene:ENSMUSG00000020695 transcript:ENSMUST00000021038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPIRPALAPWPRHLLRCVLLLGGLRLGHPADSAAALLEPDVFLIFSQGMQGCLEAQGVQ
VRVTPVCNASLPAQRWKWVSRNRLFNLGATQCLGTGWPVTNTTVSLGMYECDREALSLRW
QCRTLGDQLSLLLGARASNASKPGTLERGDQTRSGHWNIYGSEEDLCARPYYEVYTIQGN
SHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWDK
DQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGLN
DLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKK
KPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIH
SMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDC
VTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVI
YSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEV
IYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDP
TPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEH
FVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDD
IRGCAVLDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFE
HHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLHTLESDGRFR
WTDGSIINFISWAPGKPRPIGKDKKCVYMTARQEDWGDQRCHTALPYICKRSNSSGETQP
QDLPPSALGGCPSGWNQFLNKVGSWEGTRRVRGEDGNRCWLSLRHPPSCSATPFICPHTP
LCANESEVPWKVAQCWSTREQNYLNTLVSFLDQ
Download sequence
Identical sequences A2AAA9
ENSMUSP00000021038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]