SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021056 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021056
Domain Number 1 Region: 1346-1544,1571-1596
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-37
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 1024-1179,1217-1296
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-36
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 3 Region: 572-719,753-800
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.24e-31
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 130-275,379-448
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-28
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000021056
Domain Number - Region: 1600-1646
Classification Level Classification E-value
Superfamily EF-hand 0.0504
Family Calmodulin-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021056   Gene: ENSMUSG00000001027   Transcript: ENSMUST00000021056
Sequence length 1841
Comment pep:known chromosome:GRCm38:11:106318592:106349389:-1 gene:ENSMUSG00000001027 transcript:ENSMUST00000021056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSLPTLVPPGPHCLRPFTPESLAAIEQRAMEEEARLQRNKQMEIEEPERKPRSDLEA
GKNLPLIYGDPPPEVIGVPLEDLDPYYSDKKTFIVLNKGKAIFRFSATPALYMLSPFSIV
RRVAIKVLIHALFSMFIMITILTNCVFMTMSNPPSWSKDVEYTFTGIYTFESLIKMLARG
FCIDDFTFLRDPWNWLDFSVITMAYVTEFVDLGNISALRTFRVLRALKTITVIPGLKTIV
GALIQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRQKCVRWPPPMNDTNTTWYGNDTW
YGNDTWYGNDTWYGNDTWNSQESWVSNSTFDWEAYINDEGNFYFLEGSNDALLCGNSSDA
GHCPEGYECMKAGRNPNYGYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAGKTYMIF
FVVIIFLGSFYLINLILAVVAMAYAEQNEATLAEDQEKEEEFQQMLEKFKKHQEELEKAK
AAQALEGGEEADGDPTHSKDCNGSLDTSGEKGPPRPSCSAESAISDAMEELEEAHQKCPP
WWYKCAHKVLIWNCCAPWVKFKHIILLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHF
DNVLSVGNLVFTGIFTAEMVLKLIAMDPYEYFQQGWNIFDSFIVTLSLVELGLANVQGLS
VLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY
KECVCKIASDCSLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVM
VIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKWGIAFAKTFLLGLLHG
KILSLKDIMLSLGEPGGAGENGESPPEDEKKEPPPEDGNKELKDNHILNHVGLTDGPRSS
IEMDHLNFINNPYLTIHVPIASEESDLEMPTEEETDTFSEPEDIKKPLQPLYDGNSSVCS
TADYKPPEEDPEEQAEENPEGELPEECFTEACVKRCPCLYVDISQGRGKMWWTLRRACFK
IVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIQTILEYADKVFTYIFILEMLLKWVA
YGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGM
RVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISVVNNK
SECESLMYTGQVRWMNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREKEEQPDYE
VNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGKDIFMTEEQKKYYNAMKKL
GSKKPQKPIPRPQNKIQGMVYDFVTKQVFDISIMILICLNMVTMMVETDDQSQLKVDILY
NINMVFIIVFTGECVLKMFALRHYYFTIGWNIFDFVVVILSIVGLALSDLIQKYFVSPTL
FRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAY
VKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPTLENPGTNIKG
DCGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSEPLCEDDFEMFYETWEK
FDPDATQFIDYSRLSDFVDTLQEPLKIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKE
VLGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKQEEVCAIKIQRAYRRHLLQRS
VKQASYMYRHSQEGNGDGAPEKEGLLANTMNKMYGSEKEDNGVQSQGEKEKDSTEDAGPT
TEVTAPSSSDTALTPPPPSPPPPSSPPQGQTVRPGVKESLV
Download sequence
Identical sequences G3X8T7
ENSMUSP00000021056 ENSMUSP00000021056 NP_573462.2.92730 XP_006532050.1.92730 ENSMUSP00000021056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]