SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021078 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021078
Domain Number 1 Region: 143-365
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.9e-55
Family C-terminal domain of adrenodoxin reductase-like 0.00000000522
Further Details:      
 
Domain Number 2 Region: 39-201
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.29e-18
Family N-terminal domain of adrenodoxin reductase-like 0.00000452
Further Details:      
 
Domain Number 3 Region: 343-493
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000171
Family N-terminal domain of adrenodoxin reductase-like 0.00000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021078   Gene: ENSMUSG00000018861   Transcript: ENSMUST00000021078
Sequence length 494
Comment pep:known chromosome:GRCm38:11:115268024:115277050:-1 gene:ENSMUSG00000018861 transcript:ENSMUST00000021078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRCWHWWRWSAWSGLRPSPSRSTPTPGFCQKFSTQEKTPQICVVGSGPAGFYTAQHLL
KHHTHAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFQGNVVVGRDV
SVPELREAYHAVVLSYGAEDHQPLGIPGEELPGVVSARAFVGWYNGLPENQELAPDLSCD
TAVILGQGNVALDVARILLTPPEHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFT
IKELREMIQLPGTRPILDPSDFLGLQDRIKDVPRPRRRLTELLLRTATEKPGVEEAARQA
LASRAWGLRFFRSPQQVLPTPDGQRVAGIRLAVTSLEGVGESTRAVPTGDVEDLPCGLLL
SSVGYKSRPIDPSVPFDPKLGVIPNTEGRVVNVPGLYCSGWVKRGPTGVITTTMTDSFLT
SQALLEDLKAGLLPSGPRPGYVAIQALLSNRGVRPVSFSDWEKLDAEEVSRGQGTGKPRE
KLVDRREMLRLLGH
Download sequence
Identical sequences Q61578
ENSMUSP00000021078 NP_032023.1.92730 ENSMUSP00000021078 ENSMUSP00000021078 10090.ENSMUSP00000021078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]