SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021948 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021948
Domain Number 1 Region: 351-596
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.08e-78
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 196-304
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-32
Family Kringle modules 0.00069
Further Details:      
 
Domain Number 3 Region: 37-90
Classification Level Classification E-value
Superfamily Kringle-like 4.51e-19
Family Fibronectin type II module 0.0055
Further Details:      
 
Domain Number 4 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000102
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021948   Gene: ENSMUSG00000021492   Transcript: ENSMUST00000021948
Sequence length 597
Comment pep:known chromosome:GRCm38:13:55417958:55426793:-1 gene:ENSMUSG00000021492 transcript:ENSMUST00000021948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALLFLGSLLMSLDLTLSAPPWKDSKKFKDAPDGPTVVLTVDGRLCHFPFQYHRQLHHK
CIHKRRPGSRPWCATTPNFDEDQQWGYCLEPKKVKDHCSKHNPCHKGGTCINTPNGPHCL
CPEHLTGKHCQKEKCFEPQLLKFFHENELWFRTGPGGVARCECKGSEAHCKPVASQACSI
NPCLNGGSCLLVEDHPLCRCPTGYTGYFCDLDLWATCYEGRGLSYRGQAGTTQSGAPCQR
WTVEATYRNMTEKQALSWGLGHHAFCRNPDNDTRPWCFVWSGDRLSWDYCGLEQCQTPTF
APLVVPESQEESPSQAPSLSHAPNDSTDHQTSLSKTNTMGCGQRFRKGLSSFMRVVGGLV
ALPGSHPYIAALYWGNNFCAGSLIAPCWVLTAAHCLQNRPAPEELTVVLGQDRHNQSCEW
CQTLAVRSYRLHEGFSSITYQHDLALLRLQESKTNSCAILSPHVQPVCLPSGAAPPSETV
LCEVAGWGHQFEGAEEYSTFLQEAQVPFIALDRCSNSNVHGDAILPGMLCAGFLEGGTDA
CQGDSGGPLVCEEGTAEHQLTLRGVISWGSGCGDRNKPGVYTDVANYLAWIQKHIAS
Download sequence
Identical sequences Q80YC5
ENSMUSP00000021948 ENSMUSP00000021948 NP_067464.2.92730 10090.ENSMUSP00000021948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]