SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022098 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022098
Domain Number 1 Region: 65-102
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000785
Family Ribosomal protein L36 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022098   Gene: ENSMUSG00000021607   Transcript: ENSMUST00000022098
Sequence length 102
Comment pep:known chromosome:GRCm38:13:73331009:73332175:1 gene:ENSMUSG00000021607 transcript:ENSMUST00000022098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLVRSVVASVVDPFLHLSRLAVKPRVFSSFLLGTLPRAKPCAEVRSVLCGRPLPTLL
PSLGFKTKGVIKKRCKDCYKVKRRGRWFILCKTNPKHKQRQM
Download sequence
Identical sequences Q99N90
ENSMUSP00000022098 ENSMUSP00000022098 ENSMUSP00000022098 10090.ENSMUSP00000022098 NP_444393.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]