SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022176 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022176
Domain Number 1 Region: 444-583,700-860
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.09e-115
Family Substrate-binding domain of HMG-CoA reductase 0.0000000000961
Further Details:      
 
Domain Number 2 Region: 586-702
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 9.81e-45
Family NAD-binding domain of HMG-CoA reductase 0.000000701
Further Details:      
 
Domain Number 3 Region: 45-219
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.000085
Family Multidrug efflux transporter AcrB transmembrane domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022176   Gene: ENSMUSG00000021670   Transcript: ENSMUST00000022176
Sequence length 887
Comment pep:known chromosome:GRCm38:13:96648967:96670936:-1 gene:ENSMUSG00000021670 transcript:ENSMUST00000022176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASALAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTAEQAKVSLGLDEDVSKR
IEPSVSLWQFYLSKMISMDIEQVITLSLAFLLAVKYIFFEQAETESTLSLKNPITSPVVT
SKKAQDNCCRREPLLVRRNQKLSSVEEDPGANQERKVEVIKPLVVEAETTSRATFVLGAS
VASPPSALGTQEPGIELPIEPRPNEECLQILENAEKGAKFLSDAEIIQLVNAKHIPAYKL
ETLMETHERGVSIRRQLLSTKLAEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGVA
GPLCLDGKEYQVPMATTEGCLVASTNRGCRAISLGGGASSRVLADGMTRGPVVRLPRACD
SAEVKTWLETPEGFAVIKEAFDSTSRFARLQKLHVTMAGRNLYIRFQSRTGDAMGMNMIS
KGTEKALLKLQEFFPDMQILAVSGNYCTDKKPAAINWIEGRGKTVVCEAVIPAKVVREVL
KTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLM
EASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARI
VCGTVMAGELSLMAALAAGHLVRSHMVHNRSKINLQDLQGTCTKKAA
Download sequence
Identical sequences Q01237
NP_032281.2.92730 XP_006517594.1.92730 10090.ENSMUSP00000022176 ENSMUSP00000022176 ENSMUSP00000022176 ENSMUSP00000022176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]