SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022264 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022264
Domain Number 1 Region: 824-1117
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.23e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000201
Further Details:      
 
Domain Number 2 Region: 59-319
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.24e-79
Family Carbonic anhydrase 0.00000701
Further Details:      
 
Domain Number 3 Region: 1121-1408
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.4e-75
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000157
Further Details:      
 
Domain Number 4 Region: 347-441
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000722
Family Fibronectin type III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022264   Gene: ENSMUSG00000021745   Transcript: ENSMUST00000022264
Sequence length 1442
Comment pep:known chromosome:GRCm38:14:11553532:12242041:1 gene:ENSMUSG00000021745 transcript:ENSMUST00000022264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGTLQESRQDSSVQIRRRKASGDPYW
AYSGAYGPEHWVTSSVSCGGSHQSPIDILDHHARVGDEYQELQLDGFDNESSNKTWMKNT
GKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSVNGRRFPVEMQIFFYN
PDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFILRD
LLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVE
YLRNNFRPQQALNDRVVSKSAVRDAWNHDLADFLDNPLGTEASKVCSSPPIHMKVQPLNQ
TALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTW
TSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPT
ASAASKQAGRTVLATTEALASPGPDVDSAPTKDSEGTEEGEKEEKSESEDGEREHEEEEK
DSEKKEKSEATHTAAESDRTAPAPTPSSPHRTAAEGGHQTIPGRRQDHSAPATDQPGHVA
PDLDPLVDTATQVPPTATEEHYSGSDPRRPEMPSKKPMSRGDRFSEDSKFITVNPAEKNT
SGMLSRPSPGRMEWIIPLIVVSALTFVCLVLLIAVLVYWRGCNKIKSKGFPRRSREVPSS
GERGEKGSRKCFQTAHFYVEDSSSPRVVPNESVPIIPIPDDMEAIPVKQFGKHIGELYSN
SQHGFSEDFEEVQRCTADMNITAEHSNHPDNKHKNRYINILAYDHSRVKLRPLPGKDSKH
SDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQ
YWPTENTEEYGNIIVTLKSTKVHACYTVRRLSVRNTKVKKGQKGNPKGRQNERTVIQYHY
TQWPDMGVPEYALPVLTFVRRSSAARMPDMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDK
STVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSSQLHSYVNSILIPG
VGGKTRLEKQFKLITQCNAKYVECFSAQKECNKEKNRNSSVVPAERARVGLAPLPGMKGT
DYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVYW
PSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWPNPD
APISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVA
KMINLMRPGVFTDIEQYQFVYKAMLSLISTKENGNGPMTGDKNGAVLTAEESDPAESMES
LV
Download sequence
Identical sequences F8VQD7
ENSMUSP00000022264 ENSMUSP00000022264 NP_033007.2.92730 10090.ENSMUSP00000022264 ENSMUSP00000022264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]