SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022368 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022368
Domain Number 1 Region: 169-426
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.5e-77
Family Eukaryotic proteases 0.0000000338
Further Details:      
 
Domain Number 2 Region: 50-159
Classification Level Classification E-value
Superfamily Kringle-like 1.62e-32
Family Kringle modules 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022368   Gene: ENSMUSG00000021822   Transcript: ENSMUST00000022368
Sequence length 433
Comment pep:known chromosome:GRCm38:14:20836662:20843388:1 gene:ENSMUSG00000021822 transcript:ENSMUST00000022368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVWLASLFLCALVVKNSEGGSVLGAPDESNCGCQNGGVCVSYKYFSRIRRCSCPRKFQG
EHCEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNAPAVLQKPYNAHRPDAISLGLGKH
NYCRNPDNQKRPWCYVQIGLRQFVQECMVHDCSLSKKPSSSVDQQGFQCGQKALRPRFKI
VGGEFTEVENQPWFAAIYQKNKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVY
LGQSKESSYNPGEMKFEVEQLILHEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTI
CLPPRFTDAPFGSDCEITGFGKESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGSEINYK
MLCAADPEWKTDSCKGDSGGPLICNIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFLDW
IQSHIGEEKGLAF
Download sequence
Identical sequences P06869 Q0VBA8
10090.ENSMUSP00000022368 NP_032899.1.92730 XP_017171408.1.92730 ENSMUSP00000022368 ENSMUSP00000022368 ENSMUSP00000022368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]