SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022722 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022722
Domain Number 1 Region: 4-455
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 2.09e-115
Family 2-methylcitrate dehydratase PrpD 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022722   Gene: ENSMUSG00000022126   Transcript: ENSMUST00000022722
Sequence length 488
Comment pep:known chromosome:GRCm38:14:103046977:103056573:1 gene:ENSMUSG00000022126 transcript:ENSMUST00000022722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLKSVTESFAGMIHGLKVNHLTDGIIRRSKRMILDSLGVGFLGTGTEVFHKVTQYSKIY
SSNTSSTVWGRPDFRLPPTYAAFVNGVAVHSMDFDDTWHPATHPSGAVLPVLTALSEALP
QTPKFSGLDLLLAFNVGIEVQGRLMHFSKEAKDIPKRFHPPSVVGTLGSAAAASKFLGLS
LTKCREALAIAVSHAGAPIANAATQTKPLHIGNAAKHGMEATFLAMLGLQGNKQILDLGS
GFGAFYANYSPEDLPSLDSHIWLLDQQDVAFKSFPAHLATHWVADAAAAVRKHLVTPERA
LFPADHIERIVLRIPDVQYVNRPFPDSEHEARHSFQYVACASLLDGSITVPSFHSQQVNR
PQVRELLKKVKLEHPPDNPPSFDTLYCEISITLKDGTTFTERSDTFYGHWRKPLSQEDLR
NKFRANASKMLCRDTVESLITVVEKLEDLEDCSVLTRLLKGPSVQDEASKLSSMSSFDHT
TLPRFTNI
Download sequence
Identical sequences A0A0R4J027
ENSMUSP00000022722 ENSMUSP00000022722 ENSMUSP00000022722 NP_032418.1.92730 10090.ENSMUSP00000022722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]