SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023112 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023112
Domain Number 1 Region: 15-253
Classification Level Classification E-value
Superfamily HAD-like 9.45e-65
Family Predicted hydrolases Cof 0.000000000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023112   Gene: ENSMUSG00000022474   Transcript: ENSMUST00000023112
Sequence length 262
Comment pep:known chromosome:GRCm38:15:81951108:81960930:-1 gene:ENSMUSG00000022474 transcript:ENSMUST00000023112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAVEGARRKERILCLFDVDGTLTPARQKIDPEVSAFLQKLRSRVQIGVVGGSDYSKIA
EQLGEGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLR
LPKKRGTFIEFRNGMLNVSPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLR
FSRGGMISFDVFPEGWDKRYCLDSLDEDSFDIIHFFGNETSPGGNDFEIYADPRTVGHSV
VSPQDTVQRCRELFFPETAHEA
Download sequence
Identical sequences O35621 Q545Q8
ENSMUSP00000023112 NP_038900.1.92730 ENSMUSP00000023112 ENSMUSP00000023112 10090.ENSMUSP00000023112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]