SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023116 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023116
Domain Number 1 Region: 33-550
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 4.45e-168
Family Aconitase iron-sulfur domain 0.00000000000000275
Further Details:      
 
Domain Number 2 Region: 557-776
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 7.85e-65
Family LeuD-like 0.00000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023116   Gene: ENSMUSG00000022477   Transcript: ENSMUST00000023116
Sequence length 780
Comment pep:known chromosome:GRCm38:15:81872309:81915133:1 gene:ENSMUSG00000022477 transcript:ENSMUST00000023116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPSEYIRYDLLEKNINIVRKRLN
RPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAV
PSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILEN
YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG
WTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN
HRMKKYLSKTGRTDIANLAEEFKDHLVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHP
VADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGS
EQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRN
DANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRSDFDPG
QDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAA
GPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVI
GDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHP
VDKLTIQGLKDFAPGKPLKCVIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQQ
Download sequence
Identical sequences Q99KI0
ENSMUSP00000023116 ENSMUSP00000023116 NP_542364.1.92730 10090.ENSMUSP00000023116 ENSMUSP00000023116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]