SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023884 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023884
Domain Number 1 Region: 56-294
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.24e-68
Family Alanine racemase-like, N-terminal domain 0.000000187
Further Details:      
 
Domain Number 2 Region: 259-412
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.34e-35
Family Eukaryotic ODC-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023884   Gene: ENSMUSG00000023120   Transcript: ENSMUST00000023884
Sequence length 425
Comment pep:known chromosome:GRCm38:4:130209109:130222401:-1 gene:ENSMUSG00000023120 transcript:ENSMUST00000023884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTPSEVKKDLLGVAEHLRPSEPITLGPGASAWQLVLKKIKELSISGRQDAFMVADLDVL
VSRHRTFLQALPRVQPFYAVKCNSNPWVLLVLAALGTGFDCASQGELEQVLGLGVAPSRI
IFANPCKAVSHIQFAARCGVQLLTFDNEEELIKLARYHPRARLVLRIQTLDSQSTFPLHT
KFGAHLEACGHLLQVARELGLAVVGASFHVGSDCHTPESYRQAIADCHRVFEMGCKAGHH
MSLLDLGGGFPGVKGSEAKFEEVARVINTALAQYFPEETGIEVIAEPGRFYAGSVCTAAV
NIIVKKSSLDPGGHRKLAYYLNEGHYGVFRLFLRDPVPRIPIVVKEFPSEPPLFPCTLYG
PTCDAYDRLFSTEVQLPELDVGDWLIFPDMGAYSSSMSSTFNGFPIATVYDAMSPQLRSL
LETVP
Download sequence
Identical sequences Q3UNZ2
ENSMUSP00000023884 NP_001030044.1.92730 XP_006503259.1.92730 XP_006503260.1.92730 10090.ENSMUSP00000023884 ENSMUSP00000023884 ENSMUSP00000023884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]