SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000024897 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000024897
Domain Number 1 Region: 5-137
Classification Level Classification E-value
Superfamily PapD-like 1.47e-43
Family MSP-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000024897   Gene: ENSMUSG00000024091   Transcript: ENSMUST00000024897
Sequence length 249
Comment pep:known chromosome:GRCm38:17:65580056:65613555:-1 gene:ENSMUSG00000024091 transcript:ENSMUST00000024897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASASGAMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYC
VRPNSGIIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDE
LMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPLPKPHSVSLNDTETRKLMEECK
RLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDNVTSPLPSLLVVIAAIFI
GFFLGKFIL
Download sequence
Identical sequences Q9WV55
ENSMUSP00000024897 10090.ENSMUSP00000024897 ENSMUSP00000024897 NP_038961.2.92730 XP_021073348.1.100879 ENSMUSP00000024897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]