SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025007 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025007
Domain Number 1 Region: 35-175
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 3.8e-57
Family Nucleoside diphosphate kinase, NDK 0.000000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025007   Gene: ENSMUSG00000024177   Transcript: ENSMUST00000025007
Sequence length 186
Comment pep:known chromosome:GRCm38:17:26091734:26095508:-1 gene:ENSMUSG00000024177 transcript:ENSMUST00000025007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLFGRVAALRALLCGPRFQCLLVRPSSGGPPWPQERTLVAVKPDGVQRRLVGTVIQRF
ERRGFKLVGMKMLQAPESILAEHYRDLQRKPFYPALISYMSSGPVVAMVWEGPNVVHISR
AMIGHTDSTEAAPGTIRGDFSVHISRNVIHASDSVDGAQREIELWFQSSELLNWADGGHH
SSCYPA
Download sequence
Identical sequences Q9WV84
10090.ENSMUSP00000025007 NP_062705.1.92730 ENSMUSP00000025007 ENSMUSP00000025007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]