SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025354 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025354
Domain Number 1 Region: 15-361
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.75e-98
Family Protein prenyltransferases 0.00000000000994
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025354   Gene: ENSMUSG00000024477   Transcript: ENSMUST00000025354
Sequence length 377
Comment pep:known chromosome:GRCm38:18:46239949:46280850:-1 gene:ENSMUSG00000024477 transcript:ENSMUST00000025354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTEDDRLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDM
LDSLDVVNKDDIIEWIYSLQVLPTEDRSNLSRCGFRGSSYLGIPFNPSKNPGAAHPYDSG
HIAMTYTGLSCLIILGDDLGRVDKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASC
ICYMLNNWSGMDMKKAISYIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEEVF
SEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLKIFQYTNFEKNRNYILS
TQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKVHPALNVSTRTSERLRDLHQS
WKTKDSKQCSDNVHIAT
Download sequence
Identical sequences Q8BUY9
ENSMUSP00000025354 ENSMUSP00000025354 NP_766215.1.92730 10090.ENSMUSP00000025354 ENSMUSP00000025354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]