SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025418 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025418
Domain Number 1 Region: 8-129
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000000012
Family Cgl1923-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025418   Gene: ENSMUSG00000024537   Transcript: ENSMUST00000025418
Sequence length 264
Comment pep:known chromosome:GRCm38:18:67641599:67654162:1 gene:ENSMUSG00000024537 transcript:ENSMUST00000025418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCGESVPDLTNFTLLMPAVSVGNVGQLAIDLIISTLNMCKIGYFYTDCLVPMVGNNP
YATEEENSNELSINTEVYSLPSKKLVVLQLRSIFIKYKSKSFCEKLLAWVESSGCARIIV
LSSSHSYHRNDAQLRSTPFRYLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIR
IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDAVSLVEYLNEWLQIIKPCNDGPMA
SALPWKIPSSWRLLFGSGLPPALF
Download sequence
Identical sequences Q9EST4
10090.ENSMUSP00000025418 ENSMUSP00000025418 NP_598899.1.92730 ENSMUSP00000025418 ENSMUSP00000025418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]