SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025714 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025714
Domain Number 1 Region: 21-229
Classification Level Classification E-value
Superfamily PHP domain-like 1.18e-43
Family RNase P subunit p30 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025714   Gene: ENSMUSG00000024800   Transcript: ENSMUST00000025714
Sequence length 268
Comment pep:known chromosome:GRCm38:19:36083716:36104772:1 gene:ENSMUSG00000024800 transcript:ENSMUST00000025714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKREIEKPIAVSELFTT
LPIVQGKSRPIKILTRLTIIVTDPAHCNVLRATSSRVRLYDIVAVFPKTEKLFHVACTHL
DVDLVCITVTEKLPFYFKRPPVNVAIERGLGFELVYGPAIRDATMRRYTISNALNLMQIC
KGKNVILSSAAERPLEIRGPYDVANLGLLFGLSENDGKAAVSTNCRAVFLHGETRKTAFG
IISTVKKPRPSEADDESLPVCKKAKCEG
Download sequence
Identical sequences O88796
ENSMUSP00000025714 10090.ENSMUSP00000025714 NP_062301.3.92730 ENSMUSP00000025714 ENSMUSP00000025714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]