SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025740 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025740
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 2.44e-18
Family DNA polymerase processivity factor 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025740   Gene: ENSMUSG00000024824   Transcript: ENSMUST00000025740
Sequence length 389
Comment pep:known chromosome:GRCm38:19:4195198:4201603:-1 gene:ENSMUSG00000024824 transcript:ENSMUST00000025740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLITGGNVKVLGKAVHSLSRIGDELYLEPLKDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAASPGQDLLRCKILMKAFLSVFRSLAIVEKSVEKCCISLSGSHSHLVVQLHCKYGVKK
THNLSFQDCESLQAVFDPASCPHLLRTPARVLAEAVLSFPLALTEVTLGIGRGRRVILRS
YQEEEADSTSKAMVTETSIGDEDFQQLHAPEGIAVTFCLKEFRGLLSFAESANLPLTIHF
DVPGRPVIFTIEDSLLDAHFVLATLLEQDSCSQGPCSPKPHQPVPQKQAHSTPHLDDFTS
DDIDCYMIAMETTGGNEGSGAQPSTSLPPVSLASHDLAPTSEEEAEPSTVPGTPPPKKFR
SLFFGSILAPVHSPQGPNPVLAEDSDGEG
Download sequence
Identical sequences Q9Z0F6
10090.ENSMUSP00000025740 MmR256 ENSMUSP00000025740 ENSMUSP00000025740 ENSMUSP00000025740 ENSMUSP00000137976 NP_035367.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]