SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025794 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000025794
Domain Number - Region: 3-49
Classification Level Classification E-value
Superfamily ALDH-like 0.00942
Family ALDH-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025794   Gene: ENSMUSG00000037263   Transcript: ENSMUST00000025794
Sequence length 87
Comment pep:putative chromosome:GRCm38:19:3965900:3970438:1 gene:ENSMUSG00000037263 transcript:ENSMUST00000025794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTSPNLGRIINQKHFKRLQGLLGCGRVAIGGQSDEGERYIGHQTGVGPDQQRGLLWERWL
HVHDPVQPSFWRSGIEWDGQVPRQVLL
Download sequence
Identical sequences F6QPV9
ENSMUSP00000025794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]