SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025836 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025836
Domain Number 1 Region: 18-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.96e-23
Family Ribosomal L11/L12e N-terminal domain 0.00041
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.24e-16
Family Ribosomal protein L11, C-terminal domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025836   Gene: ENSMUSG00000024902   Transcript: ENSMUST00000025836
Sequence length 192
Comment pep:known chromosome:GRCm38:19:4962306:4966995:1 gene:ENSMUSG00000024902 transcript:ENSMUST00000025836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRATRTLKKPEAGGVIRSIVRAGQAIPGPPLGPILGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKIFIKPDRTFELKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVSLKHVYEI
ACVKAKDDAFAMQDVPLSSVVRSIIGSARSLGIRVVKDLSAEELEAFQKERAVFLAAQKE
ADLAAQAEAAKK
Download sequence
Identical sequences Q9CQF0
ENSMUSP00000025836 ENSMUSP00000025836 10090.ENSMUSP00000025836 NP_079829.1.92730 ENSMUSP00000025836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]