SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028362 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028362
Domain Number 1 Region: 209-348
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-32
Family C-type lectin domain 0.00051
Further Details:      
 
Domain Number 2 Region: 349-489
Classification Level Classification E-value
Superfamily C-type lectin-like 1.36e-31
Family C-type lectin domain 0.00059
Further Details:      
 
Domain Number 3 Region: 635-792
Classification Level Classification E-value
Superfamily C-type lectin-like 2.48e-28
Family C-type lectin domain 0.00097
Further Details:      
 
Domain Number 4 Region: 1111-1257
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-27
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 5 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.01e-27
Family Cysteine rich domain 0.0064
Further Details:      
 
Domain Number 6 Region: 943-1094
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-26
Family C-type lectin domain 0.0032
Further Details:      
 
Domain Number 7 Region: 1396-1516
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-26
Family C-type lectin domain 0.0034
Further Details:      
 
Domain Number 8 Region: 1537-1663
Classification Level Classification E-value
Superfamily C-type lectin-like 1.26e-25
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 9 Region: 500-625
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-18
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 10 Region: 1242-1361
Classification Level Classification E-value
Superfamily C-type lectin-like 1.63e-17
Family C-type lectin domain 0.0079
Further Details:      
 
Domain Number 11 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000163
Family Fibronectin type II module 0.0033
Further Details:      
 
Domain Number 12 Region: 802-934
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000979
Family C-type lectin domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028362   Gene: ENSMUSG00000026980   Transcript: ENSMUST00000028362
Sequence length 1723
Comment pep:known chromosome:GRCm38:2:60293760:60383231:-1 gene:ENSMUSG00000026980 transcript:ENSMUST00000028362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTGRVTPGLAAGLLLLLLRSFGLVEPSESSGNDPFTIVHENTGKCIQPLSDWVVAQDCS
GTNNMLWKWVSQHRLFHLESQKCLGLDITKATDNLRMFSCDSTVMLWWKCEHHSLYTAAQ
YRLALKDGYAVANTNTSDVWKKGGSEENLCAQPYHEIYTRDGNSYGRPCEFPFLIGETWY
HDCIHDEDHSGPWCATTLSYEYDQKWGICLLPESGCEGNWEKNEQIGSCYQFNNQEILSW
KEAYVSCQNQGADLLSIHSAAELAYITGKEDIARLVWLGLNQLYSARGWEWSDFRPLKFL
NWDPGTPVAPVIGGSSCARMDTESGLWQSVSCESQQPYVCKKPLNNTLELPDVWTYTDTH
CHVGWLPNNGFCYLLANESSSWDAAHLKCKAFGADLISMHSLADVEVVVTKLHNGDVKKE
IWTGLKNTNSPALFQWSDGTEVTLTYWNENEPSVPFNKTPNCVSYLGKLGQWKVQSCEKK
LRYVCKKKGEITKDAESDKLCPPDEGWKRHGETCYKIYEKEAPFGTNCNLTITSRFEQEF
LNYMMKNYDKSLRKYFWTGLRDPDSRGEYSWAVAQGVKQAVTFSNWNFLEPASPGGCVAM
STGKTLGKWEVKNCRSFRALSICKKVSEPQEPEEAAPKPDDPCPEGWHTFPSSLSCYKVF
HIERIVRKRNWEEAERFCQALGAHLPSFSRREEIKDFVHLLKDQFSGQRWLWIGLNKRSP
DLQGSWQWSDRTPVSAVMMEPEFQQDFDIRDCAAIKVLDVPWRRVWHLYEDKDYAYWKPF
ACDAKLEWVCQIPKGSTPQMPDWYNPERTGIHGPPVIIEGSEYWFVADPHLNYEEAVLYC
ASNHSFLATITSFTGLKAIKNKLANISGEEQKWWVKTSENPIDRYFLGSRRRLWHHFPMT
FGDECLHMSAKTWLVDLSKRADCNAKLPFICERYNVSSLEKYSPDPAAKVQCTEKWIPFQ
NKCFLKVNSGPVTFSQASGICHSYGGTLPSVLSRGEQDFIISLLPEMEASLWIGLRWTAY
ERINRWTDNRELTYSNFHPLLVGRRLSIPTNFFDDESHFHCALILNLKKSPLTGTWNFTS
CSERHSLSLCQKYSETEDGQPWENTSKTVKYLNNLYKIISKPLTWHGALKECMKEKMRLV
SITDPYQQAFLAVQATLRNSSFWIGLSSQDDELNFGWSDGKRLQFSNWAGSNEQLDDCVI
LDTDGFWKTADCDDNQPGAICYYPGNETEEEVRALDTAKCPSPVQSTPWIPFQNSCYNFM
ITNNRHKTVTPEEVQSTCEKLHSKAHSLSIRNEEENTFVVEQLLYFNYIASWVMLGITYE
NNSLMWFDKTALSYTHWRTGRPTVKNGKFLAGLSTDGFWDIQSFNVIEETLHFYQHSISA
CKIEMVDYEDKHNGTLPQFIPYKDGVYSVIQKKVTWYEALNACSQSGGELASVHNPNGKL
FLEDIVNRDGFPLWVGLSSHDGSESSFEWSDGRAFDYVPWQSLQSPGDCVVLYPKGIWRR
EKCLSVKDGAICYKPTKDKKLIFHVKSSKCPVAKRDGPQWVQYGGHCYASDQVLHSFSEA
KQVCQELDHSATVVTIADENENKFVSRLMRENYNITMRVWLGLSQHSLDQSWSWLDGLDV
TFVKWENKTKDGDGKCSILIASNETWRKVHCSRGYARAVCKIPLSPDYTGIAILFAVLCL
LGLISLAIWFLLQRSHIRWTGFSSVRYEHGTNEDEVMLPSFHD
Download sequence
Identical sequences Q60767
ENSMUSP00000028362 NYSGRC-LECT-ENSMUSP00000028362 NP_038853.2.92730 ENSMUSP00000108152 ENSMUSP00000028362 10090.ENSMUSP00000028362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]