SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028603 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028603
Domain Number 1 Region: 280-409
Classification Level Classification E-value
Superfamily ApaG-like 1.12e-40
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.58e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 6-82
Classification Level Classification E-value
Superfamily F-box domain 3.14e-16
Family F-box domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000028603
Domain Number - Region: 417-456
Classification Level Classification E-value
Superfamily ARM repeat 0.0262
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028603   Gene: ENSMUSG00000027180   Transcript: ENSMUST00000028603
Sequence length 480
Comment pep:known chromosome:GRCm38:2:104027721:104063240:1 gene:ENSMUSG00000027180 transcript:ENSMUST00000028603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVEAETGLLTLESLPTDPLLLILSFVDYRDLINCCYVSRRLSQLSTHDPLWRRHCKKY
WLISEEEKAGKSQCWRSLFIETYSDVGRYIDHYAAIKKAWRDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
IGATFTDWFTSYVNNVVSGGFPIIRDQIFRYIHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSRDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRI
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKVFNVAIPRFHMACPTFRVSIARLEMGPDEY
EEMEEEAEEEEEEENDDSADMDESDESDADENESDEGEGEARRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences Q9DC63
NP_997598.1.92730 ENSMUSP00000028603 10090.ENSMUSP00000028603 ENSMUSP00000028603 ENSMUSP00000028603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]