SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029603 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029603
Domain Number 1 Region: 498-759
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.17e-80
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 166-268
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000066
Further Details:      
 
Domain Number 3 Region: 382-485
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000883
Further Details:      
 
Domain Number 4 Region: 273-373
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 5 Region: 66-167
Classification Level Classification E-value
Superfamily Kringle-like 1.98e-18
Family Kringle modules 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029603   Gene: ENSMUSG00000027978   Transcript: ENSMUST00000029603
Sequence length 761
Comment pep:known chromosome:GRCm38:3:123446913:123506602:1 gene:ENSMUSG00000027978 transcript:ENSMUST00000029603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALARCVLAVILGALSVVARADPVSRSPLHRPHPSPPRSQHAHYLPSSRRPPRTPRFPLP
LRIPAAQRPQVLSTGHTPPTIPRRCGAGESWGNATNLGVPCLHWDEVPPFLERSPPASWA
ELRGQPHNFCRSPDGSGRPWCFYRNAQGKVDWGYCDCGQGPALPVIRLVGGNSGHEGRVE
LYHAGQWGTICDDQWDNADADVICRQLGLSGIAKAWHQAHFGEGSGPILLDEVRCTGNEL
SIEQCPKSSWGEHNCGHKEDAGVSCVPLTDGVIRLAGGKSTHEGRLEVYYKGQWGTVCDD
GWTEMNTYVACRLLGFKYGKQSSVNHFDGSNRPIWLDDVSCSGKEVSFIQCSRRQWGRHD
CSHREDVGLTCYPDSDGHRLSPGFPIRLVDGENKKEGRVEVFVNGQWGTICDDGWTDKHA
AVICRQLGYKGPARARTMAYFGEGKGPIHMDNVKCTGNEKALADCVKQDIGRHNCRHSED
AGVICDYLEKKASSSGNKEMLSSGCGLRLLHRRQKRIIGGNNSLRGAWPWQASLRLRSAH
GDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAVRVGDYHTLVPEEFEQEIGVQQIVI
HRNYRPDRSDYDIALVRLQGPGEQCARLSTHVLPACLPLWRERPQKTASNCHITGWGDTG
RAYSRTLQQAAVPLLPKRFCKERYKGLFTGRMLCAGNLQEDNRVDSCQGDSGGPLMCEKP
DESWVVYGVTSWGYGCGVKDTPGVYTRVPAFVPWIKSVTSL
Download sequence
Identical sequences O08762
ENSMUSP00000029603 ENSMUSP00000029603 10090.ENSMUSP00000029603 NP_032965.1.92730 ENSMUSP00000029603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]