SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029626 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029626
Domain Number 1 Region: 16-272
Classification Level Classification E-value
Superfamily Caspase-like 8.52e-87
Family Caspase catalytic domain 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029626   Gene: ENSMUSG00000027997   Transcript: ENSMUST00000029626
Sequence length 276
Comment pep:known chromosome:GRCm38:3:129901425:129914103:1 gene:ENSMUSG00000027997 transcript:ENSMUST00000029626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTETDGFYKSREVFDPAEQYKMDHKRRGVALIFNHERFFWHLTLPERRGTNADRDNLTRR
FSDLGFEVKCFNDLRAEELLLKIHEVSTSSHIDADCFICVFLSHGEGNHVYAYDAKIEIQ
TLTGLFKGDKCQSLVGKPKIFIIQACRGSQHDVPVVPLDMVDHQTDKLDNVTQVDAASVY
TLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLARYGSSLEFTELLTLVNRKVSQ
RRVDFCKDPDAIGKKQVPCFASMLTKKLHFCPKPSK
Download sequence
Identical sequences O08738 Q3TPJ9
10090.ENSMUSP00000029626 ENSMUSP00000029626 ENSMUSP00000029626 ENSMUSP00000029626 NP_033941.3.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]