SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029794 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029794
Domain Number 1 Region: 39-237
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 4.52e-31
Family PaaI/YdiI-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029794   Gene: ENSMUSG00000028148   Transcript: ENSMUST00000029794
Sequence length 248
Comment pep:known chromosome:GRCm38:3:94342099:94347352:1 gene:ENSMUSG00000028148 transcript:ENSMUST00000029794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRTSFQGVARLVRHKALYRSPCLLPRVHLASAFGSSTESLVARFCPEKTDLKDYALPNA
SWCSDMLSLYQEFLEKTKSGGWIKLPSFKSNRDHIQGLKLPFGLETASDKQDWRLFTRSI
QLEGQGYEYVIFFHPSEKKSVCLFQPGPYLEGAPGFAHGGSLAALMDETYSKTAYLAGEG
LFTLSLNIKFKNLIPVGSLAVLDIQVEKIEDQKLYMSCIAQSRDKQTVYAKSSGVFLQLQ
LEEQSQEQ
Download sequence
Identical sequences Q9CQJ0
ENSMUSP00000029794 400115 MmR174 ENSMUSP00000029794 ENSMUSP00000029794 10090.ENSMUSP00000029794 NP_079692.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]