SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030257 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030257
Domain Number 1 Region: 240-422
Classification Level Classification E-value
Superfamily vWA-like 0.00000000247
Family Integrin A (or I) domain 0.074
Further Details:      
 
Domain Number 2 Region: 728-836
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000785
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030257   Gene: ENSMUSG00000028532   Transcript: ENSMUST00000030257
Sequence length 1288
Comment pep:known chromosome:GRCm38:4:100776675:101004544:1 gene:ENSMUSG00000028532 transcript:ENSMUST00000030257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAREPEEEETVRPAAVVRRCPRCPGWPGAPRPPLWLLCLVACWILGAVADADFSILDEAQ
VLASQMRRLAAEELGVVTMQRIFNSLVYTEKISNGESEVQQLAKKIREKFNRYLDVVNRN
KQVVEASYTAHLTSPLTAIQDCCTIPPSMMEFDGNFNTNVSRTVSCDRLSTTVNSRAFNP
GRDLNSVLADNLKSNPGIKWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYVSTVRPQS
KHIVVILDHGASVTDTQLQIAKDAAQVILSAIDEHDKISVLTVADAVRTCSLDQCYKTYL
SPATSETKRKMSTFVSSVKPSDSPTQHAVGFHRAFQLIRSTSNSTRFQANTDMVIIYLSA
GITSKDSSEEDKKATLRVINEENGFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSG
KYGIPDRTALPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLI
MTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPY
LLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQIITVPVNSSLSWHINKLRETGKEAY
NVSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHFKQ
LATLESPTVMLSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVRNEVM
ATSHVTDEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVAN
PGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDLLP
VCNQDGGNKIRCFIMEDRGYLVAHPTLVDPKGHAPLEQQHITHKEPLVANDILNHPNFVK
KNLCNSFSDRTVQRSYKFNTSLVGDLTNLVHGSHCSKYRLTRIPGTNAFVGIVNETCDSL
AFCACSMVDRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEPVTYT
AIDPGLQDALQQCVNSRCNQRMESGDCFGVLDCEWCVVDSDGKTHLDKSYCAPQKECFGG
IVGAKSPYVDDMGAIGDEVITLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSH
QHMSPLAAQEMSVRMSNLENDRDERDDDSHEDRGIISNTRFIAAVMERHVHSPERRRRYW
GRSGTESDHGYSTMSPQEDSENPPCNNDPLSAGVDVGNHDDDLDLDTPPQTAALLSHKFH
HYRPHHPTLHHSHHLQAAVTVHTVDAEC
Download sequence
Identical sequences Q6PDJ1
ENSMUSP00000030257 10090.ENSMUSP00000030257 ENSMUSP00000030257 NP_932154.1.92730 ENSMUSP00000030257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]