SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030446 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030446
Domain Number 1 Region: 12-363
Classification Level Classification E-value
Superfamily UROD/MetE-like 3.84e-115
Family Uroporphyrinogen decarboxylase, UROD 0.00000000000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030446   Gene: ENSMUSG00000028684   Transcript: ENSMUST00000030446
Sequence length 367
Comment pep:known chromosome:GRCm38:4:116989965:116994413:-1 gene:ENSMUSG00000028684 transcript:ENSMUST00000030446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANGFGLQNFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREERDLER
LRDPAAAASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGSSSTMAQAKRW
LYQRPQASHKLLGILTDVLVPYLIGQVAAGAQALQLFESHAGHLGTELFSKFALPYIRDV
AKRVKAGLQKAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARERVGKAVT
LQGNLDPCALYASEEEIGRLVQQMLDDFGPQRYIANLGHGLYPDMDPERVGAFVDAVHKH
SRLLRQN
Download sequence
Identical sequences P70697
ENSMUSP00000030446 ENSMUSP00000030446 NP_033504.2.92730 ENSMUSP00000030446 10090.ENSMUSP00000030446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]