SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000031347 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000031347
Domain Number 1 Region: 123-191
Classification Level Classification E-value
Superfamily RILP dimerisation region 7.85e-18
Family RILP dimerisation region 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000031347
Domain Number - Region: 67-93
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0458
Family Mitotic arrest deficient-like 1, Mad1 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000031347   Gene: ENSMUSG00000029401   Transcript: ENSMUST00000031347
Sequence length 197
Comment pep:known chromosome:GRCm38:5:124463265:124478366:-1 gene:ENSMUSG00000029401 transcript:ENSMUST00000031347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDHPVREEEDGEEDEGALAKSPLQLTTDDVYDISYVVGRELMALGSDPRVTRLQFKIVR
VMEMLETLVNEGSLAVEELRMERDNLKQEVEGLRKAGVSGAQVNLGPDKMVVDLTDPNRP
RFTLQELREVLQERNKLKSQLLLVQEELQCYRSGLLPPRETPGGRREKDAVVAMGNGEKE
ERTIMKKLFSFRSGKHT
Download sequence
Identical sequences A0A0P6DAL3 Q99LE1
10090.ENSMUSP00000031347 ENSMUSP00000031347 NP_084535.1.92730 ENSMUSP00000031347 ENSMUSP00000031347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]