SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000031398 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000031398
Domain Number 1 Region: 11-368
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.09e-90
Family Extradiol dioxygenases 0.000000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000031398   Gene: ENSMUSG00000029445   Transcript: ENSMUST00000031398
Sequence length 393
Comment pep:known chromosome:GRCm38:5:123171807:123182725:-1 gene:ENSMUSG00000029445 transcript:ENSMUST00000031398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYNNKGPKPERGRFLHFHSVTFWVGNAKQAASFYCNKMGFEPLAYRGLETGSREVVSH
VIKQGKIVFVLCSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDHIVQKARERGAKIVRE
PWVEQDKFGKVKFAVLQTYGDTTHTLVEKINYTGRFLPGFEAPTYKDTLLPKLPRCNLEI
IDHIVGNQPDQEMQSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVTNYEESIKMPI
NEPAPGRKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGTEFLAAPSSYYKLLR
ENLKSAKIQVKESMDVLEELHILVDYDEKGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFG
AGNFNSLFKAFEEEQALRGNLTDLEPNGVRSGM
Download sequence
Identical sequences P49429
ENSMUSP00000031398 10090.ENSMUSP00000031398 ENSMUSP00000031398 NP_032303.1.92730 ENSMUSP00000031398 399898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]