SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000032892 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000032892
Domain Number - Region: 519-580
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0795
Family PYP-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000032892   Gene: ENSMUSG00000030657   Transcript: ENSMUST00000032892
Sequence length 953
Comment pep:known chromosome:GRCm38:7:117380979:117667751:1 gene:ENSMUSG00000030657 transcript:ENSMUST00000032892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAPCARRLARRSHSALLAALMVLLLQTLVVWNFSSLDSGAGEQRRAGAAAGAAEQQQP
AAPRRERRDLAAHLPAARGGPGGRAGGGGARGGGPGGARAQQPASRGALASRARDPQPSP
LITLETQDGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPELAKKPPS
RQKEHLQRKLDAQDKRQGQSVLGKGPKEVLPPREKATGNSSQGKDLSRHSHARKSGGGGS
PETKSDQAPKCDISGKEAISALTRAKSKHCRQEIAETYCRHKLGLLMPEKVARFCPLEGK
ANKNVQWDEDAVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNY
LHRQVLQFSRQYDNVRVTSWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAAD
YPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDTHMWRLGDRRIPEG
IAVDGGSDWFLLNRKFVEYVAFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMV
DNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAIVNQ
EIIGQLDSYLYGNYPAGTPGLRSYWENVYDEPDGIHTLSDVALTLYHSFIRLGLRRAESS
LHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHVTNLAVSKLETLETWMMPKKVFK
VASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTVTVIWVD
PVNVIAATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSN
KQPIKPEEALKLHNGPPRSAYMEQSFQSLNPVLSLHINPAQVEQARKNAAFTGTALEAWL
DSLVGGTWTAMDICTTGPTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
Download sequence
Identical sequences F8VPK6
ENSMUSP00000032892 10090.ENSMUSP00000032892 ENSMUSP00000032892 ENSMUSP00000032892 NP_783576.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]