SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033153 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033153
Domain Number 1 Region: 508-796
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-53
Family Protein kinases, catalytic subunit 0.00049
Further Details:      
 
Domain Number 2 Region: 39-234
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000000157
Family Quinoprotein alcohol dehydrogenase-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033153   Gene: ENSMUSG00000030866   Transcript: ENSMUST00000033153
Sequence length 911
Comment pep:known chromosome:GRCm38:7:122169893:122186216:-1 gene:ENSMUSG00000030866 transcript:ENSMUST00000033153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPVQRFQLWSPLGFLLQLVTLLGKLGPQVQSVRPESLLFVSTLDGSLHALNKQTGDLK
WTVKDDPIIQGPMYVTEMAFLSDPADGSLYVLGTQKQQGLMKLPFTIPELVHASPCRSSD
GVFYTGRKQDAWFVVDPESGETQMTLTTEGLSTPQLFIGRTQYTVSMHDLRTPALRWNTT
YRRYSAPLLNGSPGKYMSHLTSCGMGLLLTVDPGSGIVLWTQDLGVPVTGIYTWHQDGLH
QLPHLTLARDTLHFLVLRWGHIRLPASSYQDTATQFSSLDTQLLMTLYVGKEEAGFYVSK
ALVHAGVALVPRGLTLAPMDGPTTDEVTLQVSGEREGSPSTAVRYPSGSVALPSQWLLIG
YHEPPPVLHTTMLRVHPIPGKVSAETRASEDLHAPPVFFELLNLRREDPELHPEEKASDS
YPGLGSQDLLAATFTAILLGAWVLYLMRQQQQSPSAPAGPPDLSQDAQGQLSRDILQDQR
RFQSPSEPAQPPHDPEAGQPTVVGKISFNPKDVLGRGAGGTFVFRGQFEGRAVAVKRLLR
ECFGLVRREVQLLQESDRHPNVLRYFCTEHGPQFHYIALELCQASLQEYVESPDLDRWGL
EPTTVLQQMMSGLAHLHSLHIVHRDLKPANILMAGPDSQGQGRVVISDFGLCKKLPVGRC
SFSLHSGIPGTEGWMAPELLQLPPDSPTSAVDIFSAGCVFYYVLSGGSHPFGESLYRQAN
ILSGDPCLAQLQEETHDKVVALDLVRAMLSLLPQDRPSAGWVLAHPLFWSRAKELQFFQD
VSDWLEKEPDQGPLVSALEAGSYKVVREDWHKHISAPLQADLKRFRSYKGTSVRDLLRAM
RNKKHHYRELPAEVRQTLGQLPAGFIQYFTQRFPRLLLHTHRAMRTCASESLFLPYYPPA
LEARRPDATKS
Download sequence
Identical sequences Q9Z2E3
NP_036146.2.92730 ENSMUSP00000033153 10090.ENSMUSP00000033153 ENSMUSP00000033153 ENSMUSP00000033153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]