SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033503 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033503
Domain Number 1 Region: 20-145
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 6.34e-24
Family Extradiol dioxygenases 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033503   Gene: ENSMUSG00000031163   Transcript: ENSMUST00000033503
Sequence length 148
Comment pep:known chromosome:GRCm38:X:8004200:8018492:-1 gene:ENSMUSG00000031163 transcript:ENSMUST00000033503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDPTSESQLWRSSSQIPSPCLICRLDHIVMTVKNIEDTTMFYSKILGMEVTTFKGNRKA
LCFGDQKFNLHEVGKEFDPKAAHPVPGSLDVCLITEAPLEEVIERLKAFDVPIEEGPVFR
TGAKGPILSIYFRDPDRNLLEVSSYVTS
Download sequence
Identical sequences Q9D8I3
400464 NP_081503.1.92730 ENSMUSP00000033503 ENSMUSP00000033503 ENSMUSP00000033503 10090.ENSMUSP00000033503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]