SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033941 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033941
Domain Number 1 Region: 296-558
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.88e-84
Family Eukaryotic proteases 0.00000000371
Further Details:      
 
Domain Number 2 Region: 102-208
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-32
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 3 Region: 211-298
Classification Level Classification E-value
Superfamily Kringle-like 2.92e-29
Family Kringle modules 0.0000363
Further Details:      
 
Domain Number 4 Region: 33-82
Classification Level Classification E-value
Superfamily FnI-like domain 3.35e-19
Family Fibronectin type I module 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033941   Gene: ENSMUSG00000031538   Transcript: ENSMUST00000033941
Sequence length 559
Comment pep:known chromosome:GRCm38:8:22757744:22782847:1 gene:ENSMUSG00000031538 transcript:ENSMUST00000033941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRELLCVLLLCGLAFPLPDQGIHGRFRRGARSYRATCRDEPTQTTYQQHQSWLRPMLRS
SRVEYCRCNSGLVQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPDGFVGKRCDIDT
RATCFEEQGITYRGTWSTAESGAECINWNSSVLSLKPYNARRPNAIKLGLGNHNYCRNPD
RDLKPWCYVFKAGKYTTEFCSTPACPKGKSEDCYVGKGVTYRGTHSLTTSQASCLPWNSI
VLMGKSYTAWRTNSQALGLGRHNYCRNPDGDARPWCHVMKDRKLTWEYCDMSPCSTCGLR
QYKRPQFRIKGGLYTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWVLSAAHCFLER
FPPNHLKVVLGRTYRVVPGEEEQTFEIEKYIVHEEFDDDTYDNDIALLQLRSQSKQCAQE
SSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLF
NKTVTNNMLCAGDTRSGGNQDLHDACQGDSGGPLVCMINKQMTLTGIISWGLGCGQKDVP
GVYTKVTNYLDWIHDNMKQ
Download sequence
Identical sequences P11214
ENSMUSP00000033941 10090.ENSMUSP00000033941 ENSMUSP00000033941 NP_032898.2.92730 ENSMUSP00000033941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]