SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034121 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034121
Domain Number 1 Region: 475-1005
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.98e-148
Family alpha-mannosidase, C-terminal domain 0.00000000000843
Further Details:      
 
Domain Number 2 Region: 51-384
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.67e-121
Family alpha-mannosidase 0.0000000000751
Further Details:      
 
Domain Number 3 Region: 387-491
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 2.09e-27
Family alpha-mannosidase, domain 2 0.0000056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034121   Gene: ENSMUSG00000005142   Transcript: ENSMUST00000034121
Sequence length 1013
Comment pep:known chromosome:GRCm38:8:85083269:85098739:1 gene:ENSMUSG00000005142 transcript:ENSMUST00000034121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTGPLTSGVRAGGGNTGWLWMSSCNLGSPVLPISFLFWLLLAAPGARAAGYKTCPPTKP
GMLNVHLLPHTHDDVGWLKTVDQYYYGILSDVQHASVQYILDSVVSSLLEKPTRRFIYVE
MAFFSRWWKQQTSATQDAVRNLVRQGRLEFVNGGWVMNDEAATHYGAIVDQMTLGLRFLQ
DTFGSDGLPRVAWHIDPFGHSREQASLFAQMGFDGFFLGRIDYQDKLNRKKKLRMEELWR
ASDSLEPPAADLFTGVLPNNYNPPKYLCWDVLCTDPPVVDNPRSPEFNAKTLVNYFLKLA
SSQKGFYRTNHTVMTMGSDFHYENANMWFKNMDKLIRLVNAQQVNGSLVHVLYSTPTCYL
WELNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVG
PEANVGPYGSGDSAPLQEAMAVLQHHDAVSGTARQNVVNDYARQLAAGWGPCEVLVSNAL
ARLSHYKQNFSFCRELNISICPVSQTSERFQVTLYNPLGRKVDQMVRLPVYEGNFIVKDP
HDKNISSNVVMVPSYYSETYQWELLFPASVPALGFSTYSVAKMSDLNHQAHNLLSRPRKH
KSHHVLVIENKYMRATFDSGTGLLMKIENLEQNLSLPVSQGFFWYNASVGDEESSQASGA
YIFRPNVGKPIPVSRWAQISLVKTALVQEVHQNFSAWCSQVIRLYKGQRHLELEWTVGPI
PVRDDWGKEVISRFDTPMKTKGQFFTDSNGREILKRRDDYRPTWTLNQTEPVAGNYYPVN
TRIYITDGQMQLTVLTDRSQGGSSLQDGSLELMVHRRLLVDDDRGVSEPLLETDTGDKVR
GRHLVLLSSVSDAAARHRLLAEQEVLAPQVVLSLGGSSPYHSRATPKTQFSGLRQELPPQ
VHLLTLARWGPKMLLLRLEHQFALKEDSDRNLSSPVTLNVQNLFQTFTINYLQETTLAAN
QPLSRASRLKWMTNTGPTSYPEPSKLDPTSVTLKPMEIRTFLASVQWQEHRPA
Download sequence
Identical sequences O09159
NP_034894.2.92730 ENSMUSP00000034121 ENSMUSP00000034121 ENSMUSP00000034121 10090.ENSMUSP00000034121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]