SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034702 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034702
Domain Number 1 Region: 71-116
Classification Level Classification E-value
Superfamily LysM domain 0.00000000131
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034702   Gene: ENSMUSG00000032184   Transcript: ENSMUST00000034702
Sequence length 215
Comment pep:known chromosome:GRCm38:9:75625732:75637773:1 gene:ENSMUSG00000032184 transcript:ENSMUST00000034702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSPAPALREGGPRAHRPSAPSPPPRSRSTSEPEEAELSLSLARTKTRSYGSTASVRA
PLGAGVIERHVEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLSIPILSE
KPLLFNGLNSIDSPESETVDSSFCQEEEPVVSEEELPPPSPQDPDPKPAQPEEVSARDFL
QRLDLQIKLSTQAARKLKEESRDEESPYAASLYHS
Download sequence
Identical sequences G3X915
10090.ENSMUSP00000034702 NP_081585.2.92730 ENSMUSP00000034702 ENSMUSP00000034702 ENSMUSP00000034702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]