SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034843 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034843
Domain Number 1 Region: 11-137,211-704
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 8.34e-196
Family Aconitase iron-sulfur domain 0.000000000000364
Further Details:      
 
Domain Number 2 Region: 708-962
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.26e-72
Family LeuD-like 0.0000000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034843   Gene: ENSMUSG00000032293   Transcript: ENSMUST00000034843
Sequence length 963
Comment pep:known chromosome:GRCm38:9:54863755:54912534:1 gene:ENSMUSG00000032293 transcript:ENSMUST00000034843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPSAGYTFEYLIETLNGNSQKKFFNVPKLGGTKYDILPYSIRVLLEAAVRNCDGFLMK
KEDVMNILDWKTKQSNVEVPFFPARVVLQDFTGIPAMVDFAAMREAVKTLGGDPKKVHPA
CPTDLTVDHSLQIDFSKCAIQNAPNPGGGDLQKAGKLSPLKVQSKKLPCRGQTTCRGSCD
SGELSRNSGTFSSQIENTPVLCPFHLQPVPEPETVLKNQEVEFGRNRERLQFFKWSSGAF
KNVAVIPPGTGMAHQVNLEYLSRVVFEETDLLFPDSVVGTDSHITMVNGLGILGWGVGGI
ETEAVMLGLPVTLTLPEVVGCELTGSSNAFVTSIDIVLGITKHLRQVGVAGKFVEFFGSG
VSQLSIVDRTTIANMCPEYGAILSFFPVDNVTLRHLEHTGFDKTKLESMEKYLKAVKLFR
NDENSSEPEYSQVIQINLNSIVASVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQVA
AEKQSDTVSVRYDGSEYKLSHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVEIGLRVKP
YIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFDIVGYGCSTCVGNTAPLSEAVLNAVKQGD
LVTCGVLSGNKHFEGRLCDCVRANYLASPPLVVAYAIAGTVNIDFQTEPLGTDSTGKEIY
LHDIWPSREEVHQMEEEHVILSMFKTLKEKVEMGNKRWNSLEAPDSVLFPWDVKSTYIRC
PSFFDKLTKEPAASQPIENAHVLLYLGDSVTTDHISPAGSIARSSAAAKYLTNRGLTPRE
FNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAAELYQKEGIP
LIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLEFLPGENAD
SLGLSGREVFSLSFPEELFPGITLNIKTSTGKEFSVIASFANDVEITLYKHGGLLNFVAR
KFL
Download sequence
Identical sequences Q811J3
NP_073146.2.92730 ENSMUSP00000034843 ENSMUSP00000034843 ENSMUSP00000034843 10090.ENSMUSP00000034843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]